Lineage for d1v1bb_ (1v1b B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2511781Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2511782Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 2511788Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries)
  8. 2511792Domain d1v1bb_: 1v1b B: [100252]
    structural genomics
    complexed with atp

Details for d1v1bb_

PDB Entry: 1v1b (more details), 2.6 Å

PDB Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp
PDB Compounds: (B:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1v1bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1bb_ c.72.1.1 (B:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]}
mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
l

SCOPe Domain Coordinates for d1v1bb_:

Click to download the PDB-style file with coordinates for d1v1bb_.
(The format of our PDB-style files is described here.)

Timeline for d1v1bb_: