Lineage for d1v1ab_ (1v1a B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707937Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 707938Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 707939Family c.72.1.1: Ribokinase-like [53614] (9 proteins)
  6. 707940Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 707944Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries)
  8. 707946Domain d1v1ab_: 1v1a B: [100250]
    structural genomics
    complexed with adp, kdg

Details for d1v1ab_

PDB Entry: 1v1a (more details), 2.1 Å

PDB Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp
PDB Compounds: (B:) 2-keto-3-deoxygluconate kinase

SCOP Domain Sequences for d1v1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1ab_ c.72.1.1 (B:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]}
mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
lk

SCOP Domain Coordinates for d1v1ab_:

Click to download the PDB-style file with coordinates for d1v1ab_.
(The format of our PDB-style files is described here.)

Timeline for d1v1ab_: