Lineage for d1v1aa_ (1v1a A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591165Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 591166Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 591167Family c.72.1.1: Ribokinase-like [53614] (6 proteins)
  6. 591168Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 591174Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries)
  8. 591175Domain d1v1aa_: 1v1a A: [100249]

Details for d1v1aa_

PDB Entry: 1v1a (more details), 2.1 Å

PDB Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp

SCOP Domain Sequences for d1v1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1aa_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus}
mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
lk

SCOP Domain Coordinates for d1v1aa_:

Click to download the PDB-style file with coordinates for d1v1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1v1aa_: