SCOP 1.73: Domain d1v19b_: 1v19 B:

Lineage for d1v19b_ (1v19 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (9 proteins)

6. Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102640] (4 PDB entries)

8. Domain d1v19b_: 1v19 B: [100248]
   structural genomics
   complexed with dox

Details for d1v19b_

PDB Entry: 1v19, 2.3 Å

PDB Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus

PDB Compounds: (B:) 2-keto-3-deoxygluconate kinase

SCOP Domain Sequences for d1v19b_:

Sequence; same for both SEQRES and ATOM records:

>d1v19b_ c.72.1.1 (B:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]}
mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
lk

Timeline for d1v19b_:

• d1v19b_ first appeared in SCOP 1.67
  
• d1v19b_ appears in SCOP 1.71
  
• d1v19b_ appears in SCOP 1.75
  
• d1v19b_ appears in the current release, SCOPe 2.08