Lineage for d1v0pa_ (1v0p A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419321Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 419322Species (Plasmodium falciparum) [103289] (4 PDB entries)
    CDK2 homologue Pfpk5
  8. 419325Domain d1v0pa_: 1v0p A: [100245]

Details for d1v0pa_

PDB Entry: 1v0p (more details), 2 Å

PDB Description: structure of p. falciparum pfpk5-purvalanol b ligand complex

SCOP Domain Sequences for d1v0pa_:

Sequence, based on SEQRES records: (download)

>d1v0pa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum)}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkyst
tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
yeplpwesflkgldesgidllskmlkldpnqritakqalehayfke

Sequence, based on observed residues (ATOM records): (download)

>d1v0pa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum)}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgivtlwyrapdvlmgskkysttidiwsvgc
ifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesf
lkgldesgidllskmlkldpnqritakqalehayfke

SCOP Domain Coordinates for d1v0pa_:

Click to download the PDB-style file with coordinates for d1v0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1v0pa_: