Lineage for d1v0ba_ (1v0b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980461Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2980981Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries)
    CDK2 homologue Pfpk5
  8. 2980986Domain d1v0ba_: 1v0b A: [100241]
    mutant

Details for d1v0ba_

PDB Entry: 1v0b (more details), 2.2 Å

PDB Description: crystal structure of the t198a mutant of pfpk5
PDB Compounds: (A:) cell division control protein 2 homolog

SCOPe Domain Sequences for d1v0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0ba_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkyst
tidiwsvgcifaemvngaplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
yeplpwesflkgldesgidllskmlkldpnqritakqalehayfken

SCOPe Domain Coordinates for d1v0ba_:

Click to download the PDB-style file with coordinates for d1v0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1v0ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v0bb_