Lineage for d1v04a_ (1v04 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065620Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2065691Family b.68.6.2: Serum paraoxonase/arylesterase 1, PON1 [101895] (2 protein domains)
  6. 2065692Protein Serum paraoxonase/arylesterase 1, PON1 [101896] (2 species)
  7. 2065695Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101897] (1 PDB entry)
  8. 2065696Domain d1v04a_: 1v04 A: [100240]
    direct evolution; rabit-human sequence hybrid
    complexed with ca, po4

Details for d1v04a_

PDB Entry: 1v04 (more details), 2.2 Å

PDB Description: serum paraoxonase by directed evolution
PDB Compounds: (A:) serum paraoxonase/arylesterase 1

SCOPe Domain Sequences for d1v04a_:

Sequence, based on SEQRES records: (download)

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkypgim
sfdpdksgkillmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhp
gssstvevfkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswe
mhlglawsfvtyyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwt
ltplrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseep
kvtvvyaengtvlqgstvaavykgklligtvfhkalycdl

Sequence, based on observed residues (ATOM records): (download)

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkydksg
killmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpgssstvev
fkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglaws
fvtyyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtltplrvls
fdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyae
ngtvlqgstvaavykgklligtvfhkalycdl

SCOPe Domain Coordinates for d1v04a_:

Click to download the PDB-style file with coordinates for d1v04a_.
(The format of our PDB-style files is described here.)

Timeline for d1v04a_: