Lineage for d1uzxa_ (1uzx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939400Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2939421Protein Vacuolar protein sorting-associated [102843] (1 species)
  7. 2939422Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102844] (1 PDB entry)
  8. 2939423Domain d1uzxa_: 1uzx A: [100238]
    Other proteins in same PDB: d1uzxb_
    complexed with mes, so4

Details for d1uzxa_

PDB Entry: 1uzx (more details), 1.85 Å

PDB Description: a complex of the vps23 uev with ubiquitin
PDB Compounds: (A:) vacuolar protein sorting-associated protein vps23

SCOPe Domain Sequences for d1uzxa_:

Sequence, based on SEQRES records: (download)

>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg
tistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsngwia
lpilhcwdpaamnlimvvqelmsllheppqdq

Sequence, based on observed residues (ATOM records): (download)

>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg
tistgsipvimwvpsmypvkppfisinlenfdmntlpiqeyidsngwialpilhcwdpaa
mnlimvvqelmsllheppqdq

SCOPe Domain Coordinates for d1uzxa_:

Click to download the PDB-style file with coordinates for d1uzxa_.
(The format of our PDB-style files is described here.)

Timeline for d1uzxa_: