![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Fibrillin-1 [57227] (1 species) duplication: contains 47 EFG-like domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57228] (6 PDB entries) |
![]() | Domain d1uzjc2: 1uzj C:3605-3647 [100230] Other proteins in same PDB: d1uzja3, d1uzjb3, d1uzjc3 CBEGF22 and CBEGF23 complexed with ca |
PDB Entry: 1uzj (more details), 2.25 Å
SCOP Domain Sequences for d1uzjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzjc2 g.3.11.1 (C:3605-3647) Fibrillin-1 {Human (Homo sapiens)} edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd
Timeline for d1uzjc2: