Lineage for d1uzbb_ (1uzb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140674Protein 1-pyrroline-5-carboxylate dehydrogenase [102675] (1 species)
  7. 2140675Species Thermus thermophilus [TaxId:274] [102676] (1 PDB entry)
  8. 2140677Domain d1uzbb_: 1uzb B: [100221]
    complexed with mrd

Details for d1uzbb_

PDB Entry: 1uzb (more details), 1.4 Å

PDB Description: 1-pyrroline-5-carboxylate dehydrogenase
PDB Compounds: (B:) 1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d1uzbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzbb_ c.82.1.1 (B:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
gvqpfggfklsgtnaktgaldylrlflemkavaerf

SCOPe Domain Coordinates for d1uzbb_:

Click to download the PDB-style file with coordinates for d1uzbb_.
(The format of our PDB-style files is described here.)

Timeline for d1uzbb_: