Lineage for d1uzba_ (1uzb A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493759Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 493760Superfamily c.82.1: ALDH-like [53720] (2 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 493761Family c.82.1.1: ALDH-like [53721] (4 proteins)
  6. 493762Protein 1-pyrroline-5-carboxylate dehydrogenase [102675] (1 species)
  7. 493763Species Thermus thermophilus [TaxId:274] [102676] (1 PDB entry)
  8. 493764Domain d1uzba_: 1uzb A: [100220]

Details for d1uzba_

PDB Entry: 1uzb (more details), 1.4 Å

PDB Description: 1-pyrroline-5-carboxylate dehydrogenase

SCOP Domain Sequences for d1uzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus}
mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
gvqpfggfklsgtnaktgaldylrlflemkavaerf

SCOP Domain Coordinates for d1uzba_:

Click to download the PDB-style file with coordinates for d1uzba_.
(The format of our PDB-style files is described here.)

Timeline for d1uzba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uzbb_