SCOPe 2.01: Domain d1uz5a3: 1uz5 A:181-328

Lineage for d1uz5a3 (1uz5 A:181-328)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)

6. Protein MoeA, central domain [64104] (4 species)

7. Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102520] (1 PDB entry)

8. Domain d1uz5a3: 1uz5 A:181-328 [100219]
   Other proteins in same PDB: d1uz5a1, d1uz5a2
   complexed with so4

Details for d1uz5a3

PDB Entry: 1uz5, 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii

PDB Compounds: (A:) 402aa long hypothetical molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1uz5a3:

Sequence, based on SEQRES records:

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
pkvavistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkali
ekavnvgdvvvisggasggtkdltasvieelgevkvhgiaiqpgkptiigvikgkpvfgl
pgyptscltnftllvvplllralgregk

Sequence, based on observed residues (ATOM records):

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
pkvavistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkali
ekavnvgdvvvisggadltasvieelgevkvhgiaiqpgkptiigvikgkpvfglpgypt
scltnftllvvplllralgregk

Timeline for d1uz5a3:

• d1uz5a3 first appeared in SCOP 1.67
  
• d1uz5a3 appears in SCOP 1.75
  
• d1uz5a3 appears in SCOPe 2.02
  
• d1uz5a3 appears in the current release, SCOPe 2.08