![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
![]() | Species Archaeon Pyrococcus horikoshii, PH0582 [TaxId:53953] [102016] (1 PDB entry) |
![]() | Domain d1uz5a2: 1uz5 A:5-180 [100218] Other proteins in same PDB: d1uz5a1, d1uz5a3 complexed with so4 |
PDB Entry: 1uz5 (more details), 2.05 Å
SCOP Domain Sequences for d1uz5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz5a2 b.103.1.1 (A:5-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]} kvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgyavrae dtfmaseaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedvervn geiliykpaypglgvmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrk
Timeline for d1uz5a2: