Lineage for d1uz5a2 (1uz5 A:5-180)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568864Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 568865Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 568866Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 568871Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 568872Species Archaeon Pyrococcus horikoshii, PH0582 [TaxId:53953] [102016] (1 PDB entry)
  8. 568873Domain d1uz5a2: 1uz5 A:5-180 [100218]
    Other proteins in same PDB: d1uz5a1, d1uz5a3
    complexed with so4

Details for d1uz5a2

PDB Entry: 1uz5 (more details), 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii

SCOP Domain Sequences for d1uz5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz5a2 b.103.1.1 (A:5-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Archaeon Pyrococcus horikoshii, PH0582}
kvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgyavrae
dtfmaseaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedvervn
geiliykpaypglgvmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrk

SCOP Domain Coordinates for d1uz5a2:

Click to download the PDB-style file with coordinates for d1uz5a2.
(The format of our PDB-style files is described here.)

Timeline for d1uz5a2: