Lineage for d1uz5a1 (1uz5 A:329-402)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427879Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2427880Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 2427888Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2427923Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102009] (1 PDB entry)
  8. 2427924Domain d1uz5a1: 1uz5 A:329-402 [100217]
    Other proteins in same PDB: d1uz5a2, d1uz5a3
    complexed with so4

Details for d1uz5a1

PDB Entry: 1uz5 (more details), 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii
PDB Compounds: (A:) 402aa long hypothetical molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1uz5a1:

Sequence, based on SEQRES records: (download)

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
igkkvarlkhkvfsvkgrrqflpvklegdlavpilkgsgavtsfidadgfveipetvesl
degeevevtlfkgw

Sequence, based on observed residues (ATOM records): (download)

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
igkkvarlkhkvfsvrrqflpvklegdlavpilkgsgavtsfidadgfveipetveslde
geevevtlfkgw

SCOPe Domain Coordinates for d1uz5a1:

Click to download the PDB-style file with coordinates for d1uz5a1.
(The format of our PDB-style files is described here.)

Timeline for d1uz5a1: