Lineage for d1uz5a1 (1uz5 A:329-402)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381897Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 382060Superfamily b.85.6: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63867] (1 family) (S)
  5. 382061Family b.85.6.1: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63868] (1 protein)
  6. 382062Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (2 species)
  7. 382063Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102009] (1 PDB entry)
  8. 382064Domain d1uz5a1: 1uz5 A:329-402 [100217]
    Other proteins in same PDB: d1uz5a2, d1uz5a3
    complexed with so4

Details for d1uz5a1

PDB Entry: 1uz5 (more details), 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii

SCOP Domain Sequences for d1uz5a1:

Sequence, based on SEQRES records: (download)

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Archaeon Pyrococcus horikoshii}
igkkvarlkhkvfsvkgrrqflpvklegdlavpilkgsgavtsfidadgfveipetvesl
degeevevtlfkgw

Sequence, based on observed residues (ATOM records): (download)

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Archaeon Pyrococcus horikoshii}
igkkvarlkhkvfsvrrqflpvklegdlavpilkgsgavtsfidadgfveipetveslde
geevevtlfkgw

SCOP Domain Coordinates for d1uz5a1:

Click to download the PDB-style file with coordinates for d1uz5a1.
(The format of our PDB-style files is described here.)

Timeline for d1uz5a1: