![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
![]() | Protein Cellulase B (lichenase 5a) [101583] (1 species) |
![]() | Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries) |
![]() | Domain d1uz0a_: 1uz0 A: [100216] CBM6-2; complexed with glc-4glc-3glc-4glc complexed with ca, cl, gol |
PDB Entry: 1uz0 (more details), 2 Å
SCOPe Domain Sequences for d1uz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz0a_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]} mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw nlnwirinkth
Timeline for d1uz0a_: