![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) ![]() |
![]() | Family b.18.1.10: CBM6 [69213] (3 proteins) |
![]() | Protein Cellulase B (lichenase 5a) [101583] (1 species) |
![]() | Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries) |
![]() | Domain d1uyxb_: 1uyx B: [100211] CBM6-2; complexed with cellobiose complexed with bgc, ca |
PDB Entry: 1uyx (more details), 1.47 Å
SCOP Domain Sequences for d1uyxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyxb_ b.18.1.10 (B:) Cellulase B (lichenase 5a) {Cellvibrio mixtus} mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw nlnwirinkt
Timeline for d1uyxb_: