SCOP 1.67: Domain d1uyxa_: 1uyx A:

Lineage for d1uyxa_ (1uyx A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families)

5. Family b.18.1.10: CBM6 [69213] (3 proteins)

6. Protein Cellulase B (lichenase 5a) [101583] (1 species)

7. Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)

8. Domain d1uyxa_: 1uyx A: [100210]

Details for d1uyxa_

PDB Entry: 1uyx, 1.47 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose

SCOP Domain Sequences for d1uyxa_:

Sequence; same for both SEQRES and ATOM records:

>d1uyxa_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkt

Timeline for d1uyxa_:

• d1uyxa_ is new in SCOP 1.67
  
• d1uyxa_ appears in SCOP 1.69
  
• d1uyxa_ appears in the current release, SCOPe 2.08