Lineage for d1uyva1 (1uyv A:1482-1814)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853376Protein Acetyl-coenzyme A carboxylase, N-terminal domain [418956] (1 species)
    protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2853377Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419416] (8 PDB entries)
    Uniprot Q00955
  8. 2853386Domain d1uyva1: 1uyv A:1482-1814 [100204]
    Other proteins in same PDB: d1uyva2, d1uyvb2, d1uyvc2
    mutant

Details for d1uyva1

PDB Entry: 1uyv (more details), 2.6 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain L1705I/V1967I mutant
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1uyva1:

Sequence, based on SEQRES records: (download)

>d1uyva1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgvecirgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

Sequence, based on observed residues (ATOM records): (download)

>d1uyva1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmacirgsgliagatsrayhdiftitlvtcrs
vgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshlt
avddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d1uyva1:

Click to download the PDB-style file with coordinates for d1uyva1.
(The format of our PDB-style files is described here.)

Timeline for d1uyva1: