Lineage for d1uytc1 (1uyt C:1492-1814)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354508Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1354509Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 1354510Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 1354521Domain d1uytc1: 1uyt C:1492-1814 [100202]

Details for d1uytc1

PDB Entry: 1uyt (more details), 2.5 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1uytc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uytc1 c.14.1.4 (C:1492-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
tavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d1uytc1:

Click to download the PDB-style file with coordinates for d1uytc1.
(The format of our PDB-style files is described here.)

Timeline for d1uytc1: