Lineage for d1uytb1 (1uyt B:1482-1814)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480567Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (3 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 480568Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 480569Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (7 PDB entries)
  8. 480576Domain d1uytb1: 1uyt B:1482-1814 [100200]

Details for d1uytb1

PDB Entry: 1uyt (more details), 2.5 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain

SCOP Domain Sequences for d1uytb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uytb1 c.14.1.4 (B:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

SCOP Domain Coordinates for d1uytb1:

Click to download the PDB-style file with coordinates for d1uytb1.
(The format of our PDB-style files is described here.)

Timeline for d1uytb1: