Lineage for d1uysb1 (1uys B:1482-1814)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835938Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1835939Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 1835940Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 1835971Domain d1uysb1: 1uys B:1482-1814 [100194]
    complexed with h1l

Details for d1uysb1

PDB Entry: 1uys (more details), 2.8 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain in complex with inhibitor haloxyfop
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1uysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uysb1 c.14.1.4 (B:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d1uysb1:

Click to download the PDB-style file with coordinates for d1uysb1.
(The format of our PDB-style files is described here.)

Timeline for d1uysb1: