Lineage for d1uyra1 (1uyr A:1482-1814)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461628Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2461629Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2461630Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 2461643Domain d1uyra1: 1uyr A:1482-1814 [100188]
    complexed with d1l

Details for d1uyra1

PDB Entry: 1uyr (more details), 2.5 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain in complex with inhibitor diclofop
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1uyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d1uyra1:

Click to download the PDB-style file with coordinates for d1uyra1.
(The format of our PDB-style files is described here.)

Timeline for d1uyra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uyra2