Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins) Pfam 01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Acetyl-coenzyme A carboxylase [89573] (1 species) duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (7 PDB entries) |
Domain d1uyra1: 1uyr A:1482-1814 [100188] |
PDB Entry: 1uyr (more details), 2.5 Å
SCOP Domain Sequences for d1uyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)} piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq imynngvshltavddlagvekivewmsyvpakr
Timeline for d1uyra1: