Lineage for d1uyra1 (1uyr A:1482-1814)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577845Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 577846Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 578027Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins)
    Pfam 01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 578028Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 578029Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (7 PDB entries)
  8. 578030Domain d1uyra1: 1uyr A:1482-1814 [100188]

Details for d1uyra1

PDB Entry: 1uyr (more details), 2.5 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain in complex with inhibitor diclofop

SCOP Domain Sequences for d1uyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

SCOP Domain Coordinates for d1uyra1:

Click to download the PDB-style file with coordinates for d1uyra1.
(The format of our PDB-style files is described here.)

Timeline for d1uyra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uyra2