SCOP 1.67: Domain d1uypf2: 1uyp F:1-294

Lineage for d1uypf2 (1uyp F:1-294)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (3 families)

5. Family b.67.2.3: Beta-fructosidase (invertase), N-terminal domain [101884] (1 protein)
   Glycosyl hydrolase family 32

6. Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [101886] (1 PDB entry)

8. Domain d1uypf2: 1uyp F:1-294 [100187]
   Other proteins in same PDB: d1uypa1, d1uypb1, d1uypc1, d1uypd1, d1uype1, d1uypf1
   complexed with cit, gol, na, so4

Details for d1uypf2

PDB Entry: 1uyp, 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima

SCOP Domain Sequences for d1uypf2:

Sequence; same for both SEQRES and ATOM records:

>d1uypf2 b.67.2.3 (F:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

Timeline for d1uypf2:

• d1uypf2 is new in SCOP 1.67
  
• d1uypf2 appears in SCOP 1.69
  
• d1uypf2 appears in the current release, SCOPe 2.08