SCOPe 2.06: Domain d1uypf1: 1uyp F:295-432

Lineage for d1uypf1 (1uyp F:295-432)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
   Pfam PF08244
   flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand

6. Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries)

8. Domain d1uypf1: 1uyp F:295-432 [100186]
   Other proteins in same PDB: d1uypa2, d1uypb2, d1uypc2, d1uypd2, d1uype2, d1uypf2
   complexed with cit, gol, na, so4

Details for d1uypf1

PDB Entry: 1uyp, 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima

PDB Compounds: (F:) beta-fructosidase

SCOPe Domain Sequences for d1uypf1:

Sequence; same for both SEQRES and ATOM records:

>d1uypf1 b.29.1.19 (F:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

Timeline for d1uypf1:

• d1uypf1 first appeared in SCOP 1.67
  
• d1uypf1 appears in SCOPe 2.05
  
• d1uypf1 appears in SCOPe 2.07
  
• d1uypf1 appears in the current release, SCOPe 2.08