Lineage for d1uynx_ (1uyn X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251767Superfamily f.4.5: Autotransporter [103515] (1 family) (S)
    forms (12,14) barrel; contains a long alpha-helix running along the barrel axis
    automatically mapped to Pfam PF03797
  5. 2251768Family f.4.5.1: Autotransporter [103516] (1 protein)
  6. 2251769Protein Translocator domain of NalP [103517] (1 species)
  7. 2251770Species Neisseria meningitidis [TaxId:487] [103518] (2 PDB entries)
  8. 2251771Domain d1uynx_: 1uyn X: [100174]
    complexed with cxe, so4

Details for d1uynx_

PDB Entry: 1uyn (more details), 2.6 Å

PDB Description: translocator domain of autotransporter nalp from neisseria meningitidis
PDB Compounds: (X:) nalp

SCOPe Domain Sequences for d1uynx_:

Sequence, based on SEQRES records: (download)

>d1uynx_ f.4.5.1 (X:) Translocator domain of NalP {Neisseria meningitidis [TaxId: 487]}
aatvyadstaahadmqgrrlkavsdgldhngtglrviaqtqqdggtweqggvegkmrgst
qtvgiaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdigylkglfsy
gryknsisrstgadehaegsvngtlmqlgalggvnvpfaatgdltvegglrydllkqdaf
aekgsalgwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrdytvtggftg
ataatgktgarnmphtrlvaglgadvefgngwnglarysyagskqygnhsgrvgvgyrf

Sequence, based on observed residues (ATOM records): (download)

>d1uynx_ f.4.5.1 (X:) Translocator domain of NalP {Neisseria meningitidis [TaxId: 487]}
aatvyadstaahadmqgrrlkavsdgldhngtglrviaqtqqdggtweqggvegkmrgst
qtvgiaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdigylkglfsy
gryknsisrstgadehaegsvngtlmqlgalggvnvptgdltvegglrydllkqdafaek
gsalgwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrdytvtgphtrlva
glgadvefgngwnglarysyagskqygnhsgrvgvgyrf

SCOPe Domain Coordinates for d1uynx_:

Click to download the PDB-style file with coordinates for d1uynx_.
(The format of our PDB-style files is described here.)

Timeline for d1uynx_: