SCOPe 2.08: Domain d1uy0b_: 1uy0 B:

Lineage for d1uy0b_ (1uy0 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)

6. Protein Cellulase B (lichenase 5a) [101583] (1 species)

7. Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)

8. Domain d1uy0b_: 1uy0 B: [100173]
   CBM6-2; complexed with glc-1,3-glc-1,4-glc-1,3-glc
   complexed with ca, cl, gol, na

Details for d1uy0b_

PDB Entry: 1uy0, 1.65 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with glc-1,3-glc-1,4-glc-1,3-glc

PDB Compounds: (B:) cellulase b

SCOPe Domain Sequences for d1uy0b_:

Sequence; same for both SEQRES and ATOM records:

>d1uy0b_ b.18.1.10 (B:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

Timeline for d1uy0b_:

• d1uy0b_ first appeared in SCOP 1.67
  
• d1uy0b_ appears in SCOPe 2.07