Lineage for d1uxzb_ (1uxz B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046679Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 2046684Protein Cellulase B (lichenase 5a) [101583] (1 species)
  7. 2046685Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)
  8. 2046687Domain d1uxzb_: 1uxz B: [100171]
    CBM6-2

Details for d1uxzb_

PDB Entry: 1uxz (more details), 1.4 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a
PDB Compounds: (B:) cellulase b

SCOPe Domain Sequences for d1uxzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxzb_ b.18.1.10 (B:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

SCOPe Domain Coordinates for d1uxzb_:

Click to download the PDB-style file with coordinates for d1uxzb_.
(The format of our PDB-style files is described here.)

Timeline for d1uxzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uxza_