Lineage for d1uxza_ (1uxz A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370246Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 370247Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) (S)
  5. 370443Family b.18.1.10: CBM6 [69213] (3 protein domains)
  6. 370448Protein Cellulase B (lichenase 5a) [101583] (1 species)
  7. 370449Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)
  8. 370450Domain d1uxza_: 1uxz A: [100170]

Details for d1uxza_

PDB Entry: 1uxz (more details), 1.4 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a

SCOP Domain Sequences for d1uxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxza_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

SCOP Domain Coordinates for d1uxza_:

Click to download the PDB-style file with coordinates for d1uxza_.
(The format of our PDB-style files is described here.)

Timeline for d1uxza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uxzb_