Lineage for d1uxxx_ (1uxx X:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793067Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 793068Protein Carbohydrate binding module from xylanase U [69214] (1 species)
  7. 793069Species Clostridium thermocellum [TaxId:1515] [69215] (2 PDB entries)
  8. 793070Domain d1uxxx_: 1uxx X: [100169]
    complexed with ca, xyp

Details for d1uxxx_

PDB Entry: 1uxx (more details), 1.6 Å

PDB Description: cbm6ct from clostridium thermocellum in complex with xylopentaose
PDB Compounds: (X:) xylanase u

SCOP Domain Sequences for d1uxxx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxxx_ b.18.1.10 (X:) Carbohydrate binding module from xylanase U {Clostridium thermocellum [TaxId: 1515]}
kieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasgadt
ptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidyfi
fdsng

SCOP Domain Coordinates for d1uxxx_:

Click to download the PDB-style file with coordinates for d1uxxx_.
(The format of our PDB-style files is described here.)

Timeline for d1uxxx_: