![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) ![]() |
![]() | Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
![]() | Protein Carbohydrate binding module from xylanase U [69214] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [69215] (2 PDB entries) |
![]() | Domain d1uxxx_: 1uxx X: [100169] complexed with ca, xyp |
PDB Entry: 1uxx (more details), 1.6 Å
SCOP Domain Sequences for d1uxxx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxxx_ b.18.1.10 (X:) Carbohydrate binding module from xylanase U {Clostridium thermocellum [TaxId: 1515]} kieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasgadt ptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidyfi fdsng
Timeline for d1uxxx_: