Lineage for d1uxmd_ (1uxm D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367295Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 367296Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 367309Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 367376Species Human (Homo sapiens) [TaxId:9606] [49333] (22 PDB entries)
  8. 367415Domain d1uxmd_: 1uxm D: [100160]

Details for d1uxmd_

PDB Entry: 1uxm (more details), 1.9 Å

PDB Description: a4v mutant of human sod1

SCOP Domain Sequences for d1uxmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxmd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkvvcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1uxmd_:

Click to download the PDB-style file with coordinates for d1uxmd_.
(The format of our PDB-style files is described here.)

Timeline for d1uxmd_: