Lineage for d1uxlc_ (1uxl C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788402Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 788403Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 788416Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 788505Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)
  8. 788521Domain d1uxlc_: 1uxl C: [100149]

Details for d1uxlc_

PDB Entry: 1uxl (more details), 1.6 Å

PDB Description: i113t mutant of human sod1
PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d1uxlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxlc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1uxlc_:

Click to download the PDB-style file with coordinates for d1uxlc_.
(The format of our PDB-style files is described here.)

Timeline for d1uxlc_: