Lineage for d1ux5a_ (1ux5 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450517Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 450518Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) (S)
  5. 450519Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 proteins)
  6. 450520Protein Bni1 [101451] (1 species)
  7. 450521Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101452] (2 PDB entries)
  8. 450522Domain d1ux5a_: 1ux5 A: [100144]

Details for d1ux5a_

PDB Entry: 1ux5 (more details), 2.5 Å

PDB Description: crystal structures of a formin homology-2 domain reveal a flexibly tethered dimer architecture

SCOP Domain Sequences for d1ux5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae)}
kyprphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslas
krkedlqkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskse
iievsvnlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrm
raltvvtsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgf
klstlqrltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndc
kdfsqsivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimef
eslmhtygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikh

SCOP Domain Coordinates for d1ux5a_:

Click to download the PDB-style file with coordinates for d1ux5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ux5a_: