Lineage for d1ux2j_ (1ux2 J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333502Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1333503Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1333504Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1333505Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 1333506Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (7 PDB entries)
  8. 1333562Domain d1ux2j_: 1ux2 J: [100141]
    complexed with epe, nag, nh4, so4

Details for d1ux2j_

PDB Entry: 1ux2 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (J:) acetylcholine binding protein

SCOPe Domain Sequences for d1ux2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux2j_ b.96.1.1 (J:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
knsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1ux2j_:

Click to download the PDB-style file with coordinates for d1ux2j_.
(The format of our PDB-style files is described here.)

Timeline for d1ux2j_: