Lineage for d1ux2h_ (1ux2 H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. Domain d1ux2h_: 1ux2 H: [100139]
    complexed with epe, nag, nh4, so4

Details for d1ux2h_

PDB Entry: 1ux2 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (H:) acetylcholine binding protein

SCOPe Domain Sequences for d1ux2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux2h_ b.96.1.1 (H:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
kknsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1ux2h_ are not available.

Timeline for d1ux2h_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ux2a_, d1ux2b_, d1ux2c_, d1ux2d_, d1ux2e_, d1ux2f_, d1ux2g_, d1ux2i_, d1ux2j_