Lineage for d1ux2c_ (1ux2 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428810Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2428811Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2428860Domain d1ux2c_: 1ux2 C: [100134]
    complexed with epe, nag, nh4, so4

Details for d1ux2c_

PDB Entry: 1ux2 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (C:) acetylcholine binding protein

SCOPe Domain Sequences for d1ux2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux2c_ b.96.1.1 (C:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
kknsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1ux2c_:

Click to download the PDB-style file with coordinates for d1ux2c_.
(The format of our PDB-style files is described here.)

Timeline for d1ux2c_: