Lineage for d1ux2c_ (1ux2 C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811833Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 811834Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 811835Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 811836Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 811837Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (5 PDB entries)
  8. 811860Domain d1ux2c_: 1ux2 C: [100134]

Details for d1ux2c_

PDB Entry: 1ux2 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (C:) acetylcholine binding protein

SCOP Domain Sequences for d1ux2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux2c_ b.96.1.1 (C:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
vefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
kknsvtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1ux2c_:

Click to download the PDB-style file with coordinates for d1ux2c_.
(The format of our PDB-style files is described here.)

Timeline for d1ux2c_: