SCOPe 2.03: Domain d1uwya2: 1uwy A:1-296

Lineage for d1uwya2 (1uwy A:1-296)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase M, catalytic domain [102504] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102505] (1 PDB entry)

8. Domain d1uwya2: 1uwy A:1-296 [100131]
   Other proteins in same PDB: d1uwya1
   complexed with zn

Details for d1uwya2

PDB Entry: 1uwy, 3 Å

PDB Description: crystal structure of human carboxypeptidase m

PDB Compounds: (A:) carboxypeptidase m

SCOPe Domain Sequences for d1uwya2:

Sequence; same for both SEQRES and ATOM records:

>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ldfnyhrqegmeaflktvaqnyssvthlhsigksvkgrnlwvlvvgrfpkehrigipefk
yvanmhgdetvgrelllhlidylvtsdgkdpeitnlinstrihimpsmnpdgfeavkkpd
cyysigrenynqydlnrnfpdafeynnvsrqpetvavmkwlktetfvlsanlhggalvas
ypfdngvqatgalysrsltpdddvfqylahtyasrnpnmkkgdecknkmnfpngvtngys
wyplqggmqdynyiwaqcfeitlelscckypreeklpsfwnnnkaslieyikqvhl

Timeline for d1uwya2:

• d1uwya2 first appeared in SCOP 1.67
  
• d1uwya2 appears in SCOPe 2.02
  
• d1uwya2 appears in SCOPe 2.04
  
• d1uwya2 appears in the current release, SCOPe 2.08