Lineage for d1uwya2 (1uwy A:1-296)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587552Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 587553Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 587609Protein Carboxypeptidase M, catalytic domain [102504] (1 species)
  7. 587610Species Human (Homo sapiens) [TaxId:9606] [102505] (1 PDB entry)
  8. 587611Domain d1uwya2: 1uwy A:1-296 [100131]
    Other proteins in same PDB: d1uwya1
    complexed with nag, zn

Details for d1uwya2

PDB Entry: 1uwy (more details), 3 Å

PDB Description: crystal structure of human carboxypeptidase m

SCOP Domain Sequences for d1uwya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens)}
ldfnyhrqegmeaflktvaqnyssvthlhsigksvkgrnlwvlvvgrfpkehrigipefk
yvanmhgdetvgrelllhlidylvtsdgkdpeitnlinstrihimpsmnpdgfeavkkpd
cyysigrenynqydlnrnfpdafeynnvsrqpetvavmkwlktetfvlsanlhggalvas
ypfdngvqatgalysrsltpdddvfqylahtyasrnpnmkkgdecknkmnfpngvtngys
wyplqggmqdynyiwaqcfeitlelscckypreeklpsfwnnnkaslieyikqvhl

SCOP Domain Coordinates for d1uwya2:

Click to download the PDB-style file with coordinates for d1uwya2.
(The format of our PDB-style files is described here.)

Timeline for d1uwya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uwya1