![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
![]() | Protein Carboxypeptidase M, catalytic domain [102504] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102505] (1 PDB entry) |
![]() | Domain d1uwya2: 1uwy A:1-296 [100131] Other proteins in same PDB: d1uwya1 complexed with zn |
PDB Entry: 1uwy (more details), 3 Å
SCOPe Domain Sequences for d1uwya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ldfnyhrqegmeaflktvaqnyssvthlhsigksvkgrnlwvlvvgrfpkehrigipefk yvanmhgdetvgrelllhlidylvtsdgkdpeitnlinstrihimpsmnpdgfeavkkpd cyysigrenynqydlnrnfpdafeynnvsrqpetvavmkwlktetfvlsanlhggalvas ypfdngvqatgalysrsltpdddvfqylahtyasrnpnmkkgdecknkmnfpngvtngys wyplqggmqdynyiwaqcfeitlelscckypreeklpsfwnnnkaslieyikqvhl
Timeline for d1uwya2: