SCOPe 2.03: Domain d1uwya1: 1uwy A:297-403

Lineage for d1uwya1 (1uwy A:297-403)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (2 families)

5. Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins)

6. Protein Carboxypeptidase M C-terminal domain [101557] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101558] (1 PDB entry)

8. Domain d1uwya1: 1uwy A:297-403 [100130]
   Other proteins in same PDB: d1uwya2
   complexed with zn

Details for d1uwya1

PDB Entry: 1uwy, 3 Å

PDB Description: crystal structure of human carboxypeptidase m

PDB Compounds: (A:) carboxypeptidase m

SCOPe Domain Sequences for d1uwya1:

Sequence, based on SEQRES records:

>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi
tkviipeksqnfsalkkdillpfqgqldsipvsnpscpmiplyrnlp

Sequence, based on observed residues (ATOM records):

>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi
tkviipeksqnfsalkkdillpfqgpscpmiplyrnlp

Timeline for d1uwya1:

• d1uwya1 first appeared in SCOP 1.67
  
• d1uwya1 appears in SCOPe 2.02
  
• d1uwya1 appears in SCOPe 2.04
  
• d1uwya1 appears in the current release, SCOPe 2.08