Lineage for d1uwya1 (1uwy A:297-403)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553108Superfamily b.3.2: Carboxypeptidase regulatory domain [49464] (1 family) (S)
  5. 553109Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins)
  6. 553114Protein Carboxypeptidase M C-terminal domain [101557] (1 species)
  7. 553115Species Human (Homo sapiens) [TaxId:9606] [101558] (1 PDB entry)
  8. 553116Domain d1uwya1: 1uwy A:297-403 [100130]
    Other proteins in same PDB: d1uwya2
    complexed with nag, zn

Details for d1uwya1

PDB Entry: 1uwy (more details), 3 Å

PDB Description: crystal structure of human carboxypeptidase m

SCOP Domain Sequences for d1uwya1:

Sequence, based on SEQRES records: (download)

>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens)}
gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi
tkviipeksqnfsalkkdillpfqgqldsipvsnpscpmiplyrnlp

Sequence, based on observed residues (ATOM records): (download)

>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens)}
gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi
tkviipeksqnfsalkkdillpfqgpscpmiplyrnlp

SCOP Domain Coordinates for d1uwya1:

Click to download the PDB-style file with coordinates for d1uwya1.
(The format of our PDB-style files is described here.)

Timeline for d1uwya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uwya2