Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) |
Family b.3.2.1: Carboxypeptidase regulatory domain [49465] (2 proteins) |
Protein Carboxypeptidase M C-terminal domain [101557] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101558] (1 PDB entry) |
Domain d1uwya1: 1uwy A:297-403 [100130] Other proteins in same PDB: d1uwya2 complexed with zn |
PDB Entry: 1uwy (more details), 3 Å
SCOPe Domain Sequences for d1uwya1:
Sequence, based on SEQRES records: (download)
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi tkviipeksqnfsalkkdillpfqgqldsipvsnpscpmiplyrnlp
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gvkgqvfdqngnplpnvivevqdrkhicpyrtnkygeyyllllpgsyiinvtvpghdphi tkviipeksqnfsalkkdillpfqgpscpmiplyrnlp
Timeline for d1uwya1: