Lineage for d1uwva1 (1uwv A:15-74)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 375043Family b.40.4.12: TRAM domain [101768] (1 protein)
    Pfam 01938
  6. 375044Protein rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain [101769] (1 species)
  7. 375045Species Escherichia coli [TaxId:562] [101770] (1 PDB entry)
  8. 375046Domain d1uwva1: 1uwv A:15-74 [100128]
    Other proteins in same PDB: d1uwva2
    complexed with cl, fs4, ni, po4

Details for d1uwva1

PDB Entry: 1uwv (more details), 1.95 Å

PDB Description: crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase

SCOP Domain Sequences for d1uwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwva1 b.40.4.12 (A:15-74) rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain {Escherichia coli}
qiitvsvndldsfgqgvarhngktlfipgllpqenaevtvtedkkqyarakvvrrlsdsp

SCOP Domain Coordinates for d1uwva1:

Click to download the PDB-style file with coordinates for d1uwva1.
(The format of our PDB-style files is described here.)

Timeline for d1uwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uwva2