Lineage for d1uwjb_ (1uwj B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542478Protein B-Raf kinase [103290] (1 species)
    OPK group; RAF subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 2542479Species Human (Homo sapiens) [TaxId:9606] [103291] (2 PDB entries)
  8. 2542483Domain d1uwjb_: 1uwj B: [100126]
    complexed with bax; mutant

Details for d1uwjb_

PDB Entry: 1uwj (more details), 3.5 Å

PDB Description: the complex of mutant v599e b-raf and bay439006.
PDB Compounds: (B:) B-Raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d1uwjb_:

Sequence, based on SEQRES records: (download)

>d1uwjb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk

Sequence, based on observed residues (ATOM records): (download)

>d1uwjb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatekgsilwmapevirmqdknpysfqsdvy
afgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkk
rderplfpqilasiellarslpk

SCOPe Domain Coordinates for d1uwjb_:

Click to download the PDB-style file with coordinates for d1uwjb_.
(The format of our PDB-style files is described here.)

Timeline for d1uwjb_: