Lineage for d1uwja_ (1uwj A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874370Protein B-Raf kinase [103290] (1 species)
    OPK group; RAF subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 874371Species Human (Homo sapiens) [TaxId:9606] [103291] (2 PDB entries)
  8. 874374Domain d1uwja_: 1uwj A: [100125]

Details for d1uwja_

PDB Entry: 1uwj (more details), 3.5 Å

PDB Description: the complex of mutant v599e b-raf and bay439006.
PDB Compounds: (A:) B-Raf proto-oncogene serine/threonine-protein kinase

SCOP Domain Sequences for d1uwja_:

Sequence, based on SEQRES records: (download)

>d1uwja_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglateksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk

Sequence, based on observed residues (ATOM records): (download)

>d1uwja_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglateksgsilwmapevirmqdknpysfqsdv
yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
krderplfpqilasiellarslpk

SCOP Domain Coordinates for d1uwja_:

Click to download the PDB-style file with coordinates for d1uwja_.
(The format of our PDB-style files is described here.)

Timeline for d1uwja_: