![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein B-Raf kinase [103290] (1 species) OPK group; RAF subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103291] (2 PDB entries) |
![]() | Domain d1uwhb_: 1uwh B: [100124] complexed with bax, cl |
PDB Entry: 1uwh (more details), 2.95 Å
SCOPe Domain Sequences for d1uwhb_:
Sequence, based on SEQRES records: (download)
>d1uwhb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk amkrlmaeclkkkrderplfpqilasiellarslpk
>d1uwhb_ d.144.1.7 (B:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk krderplfpqilasiellarslpk
Timeline for d1uwhb_: