Lineage for d1uwgy2 (1uwg Y:114-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655281Domain d1uwgy2: 1uwg Y:114-215 [100122]
    Other proteins in same PDB: d1uwgh1, d1uwgl1, d1uwgl2, d1uwgx1, d1uwgx2, d1uwgy1
    part of catalytic Fab 14d9
    complexed with kha, po4

Details for d1uwgy2

PDB Entry: 1uwg (more details), 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
PDB Compounds: (Y:) antibody 14d9

SCOP Domain Sequences for d1uwgy2:

Sequence, based on SEQRES records: (download)

>d1uwgy2 b.1.1.2 (Y:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d1uwgy2 b.1.1.2 (Y:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOP Domain Coordinates for d1uwgy2:

Click to download the PDB-style file with coordinates for d1uwgy2.
(The format of our PDB-style files is described here.)

Timeline for d1uwgy2: